LL-37 - 5mg

Product Overview

LL-37 is a synthetic peptide corresponding to the active C-terminal region of the human cathelicidin antimicrobial peptide. It is commonly studied for its role in innate immune system pathways and host-defense mechanisms in research settings.

This product is supplied as a high-purity synthetic peptide intended strictly for laboratory and research applications.

Key Product Details

Form: Lyophilised powder
Quantity: 5mg per vial
Purity: ≥ 98%

Technical Specifications

Peptide Sequence: [LL-37, 37 aa]
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃ (approximate)
Molecular Weight: ~4493.3 g/mol (approximate)
Appearance: White to off-white lyophilised powder

Storage & Handling

Store at -20°C in a dry, dark environment.

Avoid repeated freeze-thaw cycles.

If already reconstituted, store between 2°C and 8°C and use within an appropriate timeframe.

This product should be handled only by qualified professionals in an appropriate laboratory setting using standard safety procedures.

Research Use Only

For laboratory research use only. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

Quality Assurance

Certificate of Analysis (COA) available above, where applicable.