VIP - 10mg

VIP - 10mg

Lyophilised Powder Vial - 10mg
£45.00 GBP
Sale price  £45.00 GBP Regular price 
Skip to product information
VIP - 10mg

VIP - 10mg

£45.00 GBP
Sale price  £45.00 GBP Regular price 
Low stock
Details

VIP (Vasoactive Intestinal Peptide)

🧬 Product Overview

VIP (Vasoactive Intestinal Peptide) is a synthetic peptide commonly studied for its interaction with neuropeptide signaling pathways and receptor-mediated biological processes in research settings.

This product is supplied as a high-purity synthetic peptide intended strictly for laboratory and research applications.

📦 Key Product Details

Form: Lyophilized Powder
Quantity: 10 mg per vial
Purity: ≥ 98%

⚗️ Technical Specifications

Peptide Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Molecular Formula: C₁₄₇H₂₃₇N₄₃O₄₃S (approximate)
Molecular Weight: ~3326.9 g/mol (approximate)
Appearance: White to off-white lyophilized powder

🧊 Storage Requirements

Store at -20°C in a dry, dark environment.

Avoid repeated freeze-thaw cycles.

If already reconstituted, store between 2°C to 8°C and use within an appropriate timeframe.

⚙️ Handling Information

This product should be handled only by qualified professionals in an appropriate laboratory setting using standard safety procedures.

🧪 Intended Use

For research and laboratory use only.

⚠️ Important Notice

  • Not for human or animal consumption
  • Not intended to diagnose, treat, cure, or prevent any disease
  • For research purposes only

📄 Quality Assurance

Certificate of Analysis (COA) available above, where applicable.

🚚 Shipping Information

Shipped under conditions suitable to maintain product stability.

Proper storage upon receipt is required.

Peptide Reconstitution & Dosage Calculator

Concentration 2.50 mg/ml
Syringe Draw (U-100) 10 Units

How it Works...

A streamlined pathway from data analysis to laboratory delivery.
  • Choose from our range of high-purity peptides with full testing data.

  • All orders must be for laboratory research purposes only.

  • Encrypted payment and fast order processing.

  • Lyophilised peptides shipped quickly and securely.

  • Store at -20°C. Reconstitute only when ready for use.

Other peptides available

Independently Tested
by Janoshik

Every Certificate of Analysis (CoA) we provide is issued in our company name and verified by Janoshik Analytical.

Unlike most UK vendors, we NEVER reuse or display third-party reports. Each batch is independently tested and documented under our name.

We spare no expense to ensure our customers receive only the highest quality research peptides.

View Our Peptide Certifications

Select an product from the dropdown to view its Janoshik Certification.