VIP - 10mg

Product Overview

VIP (Vasoactive Intestinal Peptide) is a synthetic peptide commonly studied for its interaction with neuropeptide signaling pathways and receptor-mediated biological processes in research settings.

This product is supplied as a high-purity synthetic peptide intended strictly for laboratory and research applications.

Key Product Details

Form: Lyophilised powder
Quantity: 10 mg per vial
Purity: ≥ 98%

Technical Specifications

Peptide Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂
Molecular Formula: C₁₄₇H₂₃₇N₄₃O₄₃S (approximate)
Molecular Weight: ~3326.9 g/mol (approximate)
Appearance: White to off-white lyophilised powder

Storage & Handling

Store at -20°C in a dry, dark environment.

Avoid repeated freeze-thaw cycles.

If already reconstituted, store between 2°C and 8°C and use within an appropriate timeframe.

This product should be handled only by qualified professionals in an appropriate laboratory setting using standard safety procedures.

Research Use Only

For laboratory research use only. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease.

Quality Assurance

Certificate of Analysis (COA) available above, where applicable.